Close
$87.25
AVAILABILITY: IN STOCK
IGF-1 LR3, or insulin-like growth factor-1 long arginine 3, is a modified IGF-1 analog studied in laboratory research for its relationship with IGF-1 receptor signaling, cellular growth models, protein synthesis pathways, and metabolic signaling. Research involving IGF-1 LR3 often focuses on receptor-mediated activity and how modified IGF-1 analogs behave in controlled laboratory conditions. This product is intended strictly for laboratory research purposes only and is not intended for human or veterinary use.
All products are manufactured in ISO-certified facilities and meet strict quality standards.
Product Name: IGF-1 LR3 Research Peptide
Size: 1 mg
Format: Lyophilized powder
Category: Growth Factor Signaling Research
Intended Use: For Laboratory Research Only
Testing: Third-Party Tested
Storage: Store lyophilized material in a cool, dry place. Refrigerated storage is commonly used for long-term stability. Protect from heat and direct light.
Studied in laboratory models involving IGF-1 receptor activity, ligand-binding research, and cellular signaling pathways.
Referenced in research involving cell proliferation models, tissue-response pathways, and controlled growth factor signaling studies.
Studied in relation to anabolic signaling pathways, amino acid uptake models, and cellular protein synthesis research.
Access the Certificate of Analysis for this product.
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molecular Formula: C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular Weight: 9117.5 g/mol / approximately 9.1 kDa
Appearance: White to off-white lyophilized powder
Purity: Refer to batch-specific COA
Solubility: For laboratory handling only; refer to product documentation or batch-specific COA
Source: Synthetic peptide
This product is intended exclusively for laboratory research purposes. It is not intended for human or veterinary use, safety, or diagnostics.
1. What is IGF-1 LR3 peptide?
IGF-1 LR3 is a modified research peptide analog of insulin-like growth factor-1 studied for its relationship with IGF-1 receptor signaling, cellular growth models, and metabolic pathway research.
2. What is IGF-1 LR3 studied for?
IGF-1 LR3 is commonly studied in laboratory models involving IGF-1 receptor activity, cellular growth signaling, protein synthesis pathways, tissue-response research, and metabolic signaling.
3. What does LR3 mean in IGF-1 LR3?
LR3 refers to “long arginine 3,” a modified version of IGF-1 used in research contexts. This modification is commonly discussed in relation to altered peptide behavior and receptor-signaling studies.
4. Is IGF-1 LR3 the same as IGF-1?
No. IGF-1 LR3 is a modified analog of IGF-1. It is commonly studied separately because structural changes may affect its behavior in laboratory research models.
Learn the basic research context, structure, and laboratory relevance of peptides in scientific studies.
Explore IGF-1 LR3 research areas, IGF-1 receptor signaling, cellular growth models, and laboratory study context.
