Close
$76.50
AVAILABILITY: IN STOCK
This product is intended for laboratory research purposes only. It is not intended for human or veterinary use, diagnosis, prevention, or treatment of any disease.
LL-37 is a research peptide commonly associated with cathelicidin-derived peptide research and host-defense peptide pathway studies. It is frequently referenced in laboratory literature as the active C-terminal peptide fragment of human cathelicidin hCAP-18, with research interest focused on innate immune signaling, epithelial barrier models, inflammatory response pathways, membrane interaction studies, and peptide-related cellular activity.
In controlled research settings, LL-37 may be studied to evaluate peptide-membrane interaction, immune-response models, epithelial pathway activity, cellular signaling, and molecular behavior connected to antimicrobial peptide research. Its research relevance is centered on how cathelicidin-related peptide pathways may be evaluated within immune, epithelial, and cellular response models
All products are manufactured in ISO-certified facilities and meet strict quality standards.
Product Name: LL-37 Research Peptide
Compound Reference: LL-37 / Cathelicidin-Derived Peptide
Size: 10 mg
Format: Lyophilized powder
Category: Immune & Inflammatory Pathway Research
Research Focus: Cathelicidin-derived peptide pathways, host-defense peptide models, innate immune signaling, epithelial barrier research, and cellular response systems
Intended Use: Laboratory Research Only
Testing: Third-Party Tested
Storage: Store according to label and COA guidance
Returns: Refer to return policy
Referenced in research models involving cathelicidin-derived peptide activity, host-defense peptide structure, and peptide-related pathway interaction.
Studied in laboratory models related to innate immune pathways, inflammatory response research, and immune-regulatory signaling.
Used in research involving epithelial pathway models, membrane interaction studies, and peptide-associated cellular response.
Access the Certificate of Analysis for this product.
Sequence: [LL-37, 37 aa]
Amino Acid Length: 37 amino acids
Molecular Formula: Refer to COA
Molecular Weight: Approximately 4493 Da
Appearance: Lyophilized powder
Purity: Refer to COA
Solubility: Research solvent dependent
Source: Synthetic peptide
This product is intended exclusively for laboratory research purposes. It is not intended for human or veterinary use, safety, or diagnostics.
LL-37 is a research peptide associated with cathelicidin-derived peptide research and is commonly referenced in laboratory studies involving host-defense peptide models, innate immune signaling, and cellular response systems.
LL-37 is studied because of its connection to cathelicidin peptide pathways, innate immune signaling models, epithelial barrier research, inflammatory response studies, membrane interaction, and peptide-related cellular activity.
LL-37 is commonly referenced as a cathelicidin-derived peptide and is associated with human antimicrobial peptide research, host-defense peptide models, and hCAP-18-related pathway studies.
LL-37 is commonly associated with research on cathelicidin peptide pathways, innate immune signaling, epithelial barrier models, inflammatory response research, membrane interaction, and peptide-related cellular response.
Compare how peptides and hormones are defined in research, including structural differences, signaling roles, receptor activity, and laboratory classification.
Explore research areas, published literature, cathelicidin peptide pathways, innate immune signaling, and epithelial barrier models associated with LL-37.
